SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054674 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054674
Domain Number 1 Region: 36-144
Classification Level Classification E-value
Superfamily Cystatin/monellin 1.53e-30
Family Cystatins 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054674   Gene: ENSBTAG00000004273   Transcript: ENSBTAT00000066106
Sequence length 145
Comment pep:known_by_projection chromosome:UMD3.1:13:42951021:42960765:1 gene:ENSBTAG00000004273 transcript:ENSBTAT00000066106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPAGALLAVCGLVLGVLGKSSPDFCSQILKSDAKPGFPKTIKTNDPDVLRAARHSAESF
NNCSNDAFLFRESRVSRALVQIVKGLKFMLDMDIGRTTCKKTGHANLDDCSFQTNHTLQW
TLSCYSEVWVVPWLQTTEVSLLHCH
Download sequence
Identical sequences G3MYN8
ENSBTAP00000054674 ENSBTAP00000054674 XP_002692220.1.76553 XP_875213.2.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]