SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054698 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054698
Domain Number 1 Region: 17-131
Classification Level Classification E-value
Superfamily Kringle-like 4.83e-28
Family Kringle modules 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054698   Gene: ENSBTAG00000020190   Transcript: ENSBTAT00000064402
Sequence length 455
Comment pep:known_by_projection chromosome:UMD3.1:25:2372471:2377363:1 gene:ENSBTAG00000020190 transcript:ENSBTAT00000064402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTRPPKALLLLLLLRLLPPRGASAGSLQSPGLSECFQVNGADYRGHQNRTGPRGAGRPC
LYWDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCH
MPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDL
ARGRPAPATDCDQICFGHPGQLCGGDGRLGIYEEEGTNGLIRTGWTGPEEGTNLAELGME
EGPAKPIRAKREKPRASLRKLQPVMRVGQLEEAEGKLQRGARRGQHPATVRPLSPPPPPR
PRLGSSAPPAGLTPLSSGLQDADADPAPLEGSTQTPAVPLDGANVSCSPGPGGPEASMGA
QVFSTVTAVSVLLLLVLSLLRLLRGRGCLLAPGKGSPTLGPSRDPTRSWAVWYRRPRGVA
LPCPPGDPQVEGLTASYRPLSASSQSSLRSLISAL
Download sequence
Identical sequences G3MYR1
ENSBTAP00000054698 ENSBTAP00000054698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]