SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054725 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054725
Domain Number 1 Region: 7-162
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.36e-58
Family Dual specificity phosphatase-like 0.0000017
Further Details:      
 
Domain Number 2 Region: 125-333
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.8e-46
Family Dual specificity phosphatase-like 0.000000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054725   Gene: ENSBTAG00000031439   Transcript: ENSBTAT00000065355
Sequence length 626
Comment pep:known_by_projection chromosome:UMD3.1:3:42934887:43107421:-1 gene:ENSBTAG00000031439 transcript:ENSBTAT00000065355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAESGELIGACEFMKDRLYFATLRNRPKSTVNTHYFSIDEELVYENFYADFGPLNLAMV
YRYCCKLNKKLKSYSLSRKRIVHYTCFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLS
GSNPPYLPFRDASFGNCTYNLTILDCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDF
NWIVPGKFLAFSGPHPKSKIENGYPLHAPEAYFPYFKKHNVTAVVRLNKKIYEAKRFTDA
GFEHYDLFFIDGSTPSDNIVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFT
HAEIIAWIRICRPGSIIGPQQHFLEEKQASLWVQGDIFRSKLKNRPSSEGSINKILSSLD
DMSIGGNLSKIHNMERFGENNLEEDEDVEMKNNITQGDKLRALKSQRQPRTSPSCAFRLE
DMKGHPRAVSQPSRLGSSPQGSASPLKTSKVALSPSVTAKRINRGSVSSGASVRSFSINS
RLASSLGNLNAAADDPENKKTTSPSKMGFIANPFTNLLNGSSQPPARNYPELNNNQYSRS
SNSSGSAPSSQPGPHGAKTTEEHSTALRPSYTGLSSSSARFLSRSIPVSSQTTPPLGPQN
PELNFCALPSQPRLPPKKFNSAKEAF
Download sequence
Identical sequences G3MYT6
ENSBTAP00000054725 ENSBTAP00000054725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]