SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054780 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054780
Domain Number 1 Region: 3-246
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.87e-43
Family Eukaryotic proteases 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054780   Gene: ENSBTAG00000035707   Transcript: ENSBTAT00000066259
Sequence length 267
Comment pep:novel chromosome:UMD3.1:8:65908757:65918894:1 gene:ENSBTAG00000035707 transcript:ENSBTAT00000066259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSKVMGRIYGGRDVEAGQCLQQTRLQSQGSHVCGAVLINSRWVVGSLRKGKEIQSPVELR
GLLGSTQLYQHTQHTREVSVSQIITHLDSEKLHPFGSGITILQLLFPVNFTSYIIPACLP
VPAMKLPSNSSCWIPGWGISIIDKLSDCPVPLEALGKSGKKTQRYYKDFELMLSSWGSVH
VNTLCAGDFSTGTSICRSDSGGPLVCDFTSWVLMGLASWGFDCQYPINPSIFTNVTNWID
KIQRLIPLPSPHLLSSTDPVSTTASSL
Download sequence
Identical sequences G3MYZ1
ENSBTAP00000054780 ENSBTAP00000054780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]