SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054854 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054854
Domain Number 1 Region: 48-144
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-25
Family SH2 domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054854   Gene: ENSBTAG00000047166   Transcript: ENSBTAT00000063014
Sequence length 469
Comment pep:known_by_projection chromosome:UMD3.1:21:30998214:31006059:1 gene:ENSBTAG00000047166 transcript:ENSBTAT00000063014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAHLRQLSLGRGPKGAGDRQALAELQELALSWFMETQAPLILQNGVLPAWFHGFITRKQ
TEQLLRDKALGSFLIRLSDRATGYILSYRGSDRCRHFVINQLRNRRYLISGDTQSHGTLA
ELVHHYQEVQFEPFGETLSAACPRMEDNDLYDAITVGLHQTDPSLEYPPEEASSPPASPK
HQVSSLHKRRSLDASPRNLSEEESMEAPVKVPPLPERRGSLLSNSFGGSNDIIYADLRKM
NQARLGLGTDISGWQGPVPGGSQACSPGKEAQRRLSDGSQNKPDGPGPSLSGVSPDQGPR
VSPISWGLLLPSSSEASGSSGATWSQGSPKLSRGAQPCFQSSCADTYESIWTEDVPEDTR
DVPRREDGSAHEQIAVCWGSPARTPYPGMGPTYSKLSGFTDSGYERISEVPELPEPRHTY
EQIPGASSQEQGGWTDTQIQAARSKEAGRTHKVGSRVGRGGYQPAESYW
Download sequence
Identical sequences G3MZ61
ENSBTAP00000054854 XP_002696709.1.76553 XP_003583788.2.59421 ENSBTAP00000054854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]