SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054975 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054975
Domain Number 1 Region: 4-89
Classification Level Classification E-value
Superfamily EF-hand 9.08e-21
Family Parvalbumin 0.0000563
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054975   Gene: ENSBTAG00000046943   Transcript: ENSBTAT00000063886
Sequence length 91
Comment pep:novel chromosome:UMD3.1:25:38492938:38495056:1 gene:ENSBTAG00000046943 transcript:ENSBTAT00000063886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSDPDTFEPQKFFQTSGLAKMSASQVKDVFRFIDNDQSGYLDEEELKFFLQKFESGAREL
TESETKSLMAAADNDGDGKIGADEFQEMVHS
Download sequence
Identical sequences G3MZH8
ENSBTAP00000054975 ENSBTAP00000054975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]