SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055003 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055003
Domain Number 1 Region: 70-122
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000135
Family Viral proteases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055003   Gene: ENSBTAG00000045703   Transcript: ENSBTAT00000064176
Sequence length 413
Comment pep:known chromosome:UMD3.1:26:20533690:20550733:-1 gene:ENSBTAG00000045703 transcript:ENSBTAT00000064176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRLLFTPLTAFLGSPCLRLLVPRVAPRTQCGCSCGIRRPLRPGQYSTISDVALQPGRST
VSLPSKAAERVVGRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSKEEW
EAEFQKYQQFPEFKILNHDMTLAEFKFIWYMEYSHRMWGRLVGLAYILPAAYFWKKGWLT
RGLKGRVLALCGLVCFQGLLGWYMVKSGLEEKPDSHDIPRVSQYRLAAHLGSALVLYCAS
LWTSLSLLLPQHKLTETRQLLRLRRFAHGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMG
ESWIPEDLFTFSPLLRNVFENPTMVQFDHRVLGIASVTAVTVLYFLSRRIPLPRRTKIAA
TTLLALAYTQVGLGISTLLMYVPTPLAATHQSGSLALLSVALWLMNELRRVPK
Download sequence
Identical sequences Q08DG6
NP_001070329.1.59421 NP_001070329.1.76553 ENSBTAP00000055003 ENSBTAP00000055003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]