SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055007 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055007
Domain Number 1 Region: 9-106
Classification Level Classification E-value
Superfamily EF-hand 1.21e-27
Family Calmodulin-like 0.0000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055007   Gene: ENSBTAG00000046725   Transcript: ENSBTAT00000065038
Sequence length 106
Comment pep:known chromosome:UMD3.1:13:75316423:75318650:-1 gene:ENSBTAG00000046725 transcript:ENSBTAT00000065038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAI
IEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKTEEELAECFRIFDR
Download sequence
Identical sequences G3MZK7
ENSBTAP00000055007 ENSBTAP00000055007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]