SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055052 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055052
Domain Number 1 Region: 3-131
Classification Level Classification E-value
Superfamily Bactericidal permeability-increasing protein, BPI 8.37e-24
Family Bactericidal permeability-increasing protein, BPI 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055052   Gene: ENSBTAG00000010112   Transcript: ENSBTAT00000065662
Sequence length 162
Comment pep:known_by_projection chromosome:UMD3.1:13:62880454:62883754:1 gene:ENSBTAG00000010112 transcript:ENSBTAT00000065662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTGIFQCVSTGMTITGKSFMGGNMEIIVVLNITATNRLLQDEETGLPMFKSEGCEIILVS
VKTNLPSNMLPKMVNKFLDSTLHKVLPGLMCPAIDAVLVYVNKKWASLNAPMPVGQMGTV
QYVLTSVPTTTPSYIQVDFSPVVQQQKGNTIQLADAGGAEFP
Download sequence
Identical sequences G3MZQ0
ENSBTAP00000055052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]