SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055064 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055064
Domain Number 1 Region: 689-797
Classification Level Classification E-value
Superfamily SRCR-like 1.19e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000722
Further Details:      
 
Domain Number 2 Region: 913-1024
Classification Level Classification E-value
Superfamily SRCR-like 2.35e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 344-452
Classification Level Classification E-value
Superfamily SRCR-like 8.11e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000916
Further Details:      
 
Domain Number 4 Region: 557-663
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0045
Further Details:      
 
Domain Number 5 Region: 105-213
Classification Level Classification E-value
Superfamily SRCR-like 7.06e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0048
Further Details:      
 
Domain Number 6 Region: 239-347
Classification Level Classification E-value
Superfamily SRCR-like 7.85e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0022
Further Details:      
 
Domain Number 7 Region: 796-900
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0015
Further Details:      
 
Domain Number 8 Region: 453-557
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-29
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0018
Further Details:      
 
Domain Number 9 Region: 2-106
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055064   Gene: ENSBTAG00000039380   Transcript: ENSBTAT00000065821
Sequence length 1154
Comment pep:novel chromosome:UMD3.1:5:102489629:102521321:1 gene:ENSBTAG00000039380 transcript:ENSBTAT00000065821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSVRLFGGDRPCSGRVEVHSGKAWIPVSDGNFTLSTAQVICAELGCGKAVSVLKHMPFRE
SDGQVWAEEFRCEGEEPELRVCPRVPCPGGMCHHSGAAQIACSAYLEVRLMTNGSSQCEG
QVEMNISGRWRALCASHWSLANANVVCRQLGCGVAISTPRGPHLVGRDDQISTVRFHCLG
AESFLWSCPVTALGGSGCSHGNTASVICSGNQTQVLPQCSDSLSEPTGSAASENSAPYCS
EFLALRMVSEDQQCAGWLEVFYNGTWGSVCRSPMEDITVSMICRQLGCGESGTLNSSVGL
REGSRPQWVDGIRCQKSDTSLWQCPSDPWNYTSCSPKEEAYILCEDSRQLRVVDGRGPCA
GRVEILDQGSWGTICDNGWDLDDARVVCRQLGCGDALSAMGSAHFGAGSGRILLNTLDCR
GKESHVWKCPSQGWRVHNCSHENDAGVVCSGFVRLVGDDGPCSGRVEVRPGKDWTPVSDG
NFTLPTAQVICAELGCGEAVSVLGHELFRESDGQVWAEEFRCEGKERKLWWCPRVPCPGG
TCHHSGAAQVVCSAYSEVRLMTNGSSQCEGQVEMKISGRWRALCASHWSLANANVVCRQL
GCGVAISTSRGPHLVERGGQISTVRFHCSGAESFLWSCPVTVLGGPDCSHGNTASVTCSG
NQTQVLPQCNDAVSEPAGSVASEESAPYCSDSRQLRLVDGGGPCAGRVEILDQGSWGTIC
DDGWDLDDAHVVCRQLGCGQALNATRSAHFGEGSGPIWLDDLNCTGKESHVWRCPSRGWG
RHDCRHKEDAGVICSEFLALRMVSGDQECAGWLEVFYNGTWGSVCRSPMDDVTVSILCSQ
LGCGDSGSLNTSVGLREGSRPHWVDGIQCQRTDASLWQCPSDPWNYNSCSPKEEAYISCA
VRRPKSCPTAAPCTDREKLRLRGGDSECSGRVEVWHSGSWGTVCDDSWSLAEAEVVCQQL
GCGQALEAVRAATFGPGNGSIWLDEVRCGGRESSLWECAAEPWGQSDCKHEEDAGVRCSG
VRTTLPTTTAGTRTTSNPLPGIFSLPGILCLILGALLFLVLIILVTQLLRWRAERRALSS
YEDALAEAVYEELDYLLTQKEGLGSPDQRTDVPAENYDDAEEVPVPGTPSASQGSEEEVP
PEKEDGVRSSQTGE
Download sequence
Identical sequences G3MZR1
ENSBTAP00000055064 ENSBTAP00000055064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]