SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055082 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055082
Domain Number 1 Region: 136-300
Classification Level Classification E-value
Superfamily Cyclophilin-like 3.65e-71
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000278
Further Details:      
 
Domain Number 2 Region: 4-88
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.22e-27
Family Canonical RBD 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055082   Gene: ENSBTAG00000047314   Transcript: ENSBTAT00000063035
Sequence length 301
Comment pep:known chromosome:UMD3.1:3:106917951:106934190:-1 gene:ENSBTAG00000047314 transcript:ENSBTAT00000063035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDA
AAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSE
PPKVETQEGEPTVKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEK
GFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG
PNTNGSQFFLTCDKTDWLDGKHVVFGEITDGLDVLRQIEAQGSKDGKPKQKVIISDCGEY
V
Download sequence
Identical sequences G3MZS9
ENSBTAP00000055082 ENSBTAP00000055082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]