SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055104 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055104
Domain Number 1 Region: 82-157
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.15e-31
Family Skp1 dimerisation domain-like 0.0000075
Further Details:      
 
Domain Number 2 Region: 3-67
Classification Level Classification E-value
Superfamily POZ domain 1.57e-19
Family BTB/POZ domain 0.0000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055104   Gene: ENSBTAG00000046232   Transcript: ENSBTAT00000063619
Sequence length 160
Comment pep:novel chromosome:UMD3.1:9:28544216:28544698:1 gene:ENSBTAG00000046232 transcript:ENSBTAT00000063619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTVLEDLGMDDEGDDDPVPLPNVNAAILKKWCT
HHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTV
ANMIKGKTREEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
Download sequence
Identical sequences G3MZV0
ENSBTAP00000055104 ENSBTAP00000055104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]