SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055134 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055134
Domain Number 1 Region: 30-137
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00015
Further Details:      
 
Domain Number 2 Region: 176-217
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000144
Family Scavenger receptor cysteine-rich (SRCR) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055134   Gene: ENSBTAG00000046848   Transcript: ENSBTAT00000065205
Sequence length 222
Comment pep:novel chromosome:UMD3.1:26:19219743:19222118:1 gene:ENSBTAG00000046848 transcript:ENSBTAT00000065205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWFLPAALPLLPLLLLLGQAPPSRPQSLGTMKLRLVGPGSGPEEGRLEVLHQGQWGTVCD
DDFALQEATVACRQLGFEGALTWAHSAKYGSGEGPIWLDNVHCVGTESSLDQCGSNGWGV
SDCTHSEDVGVVCNPQRHRGSVSERVSNALGPQDRRLEEVRLKPILASAKRQSPVTEGAV
EVKYEGHWRQVCDQGWTRNNSRVVCGMLGFPSEAPVDSHHYR
Download sequence
Identical sequences G3MZY0
ENSBTAP00000055134 ENSBTAP00000055134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]