SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055171 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055171
Domain Number 1 Region: 132-198
Classification Level Classification E-value
Superfamily SH3-domain 5.38e-23
Family SH3-domain 0.00013
Further Details:      
 
Domain Number 2 Region: 6-67
Classification Level Classification E-value
Superfamily SH2 domain 1.01e-18
Family SH2 domain 0.00017
Further Details:      
 
Domain Number 3 Region: 223-305
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000223
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055171   Gene: ENSBTAG00000045548   Transcript: ENSBTAT00000066024
Sequence length 308
Comment pep:known_by_projection chromosome:UMD3.1:17:74286482:74297800:1 gene:ENSBTAG00000045548 transcript:ENSBTAT00000066024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGVFLVRDSSTCPGDYVLSVSENSRVSH
HIAPPPPPRSDRLWAVGLHAVDDVCSLGSRSLVSIHRLSPELLVEPAGPWYPSPPVGSVS
APSLPAAEETLEYVRTLYDFPGNDAEDLPFKKGEILVIVEKPEEQWWSARNKDGRVGMIP
VPYVEKLVRASAQGKPGNRNSSSYGVPEPAHAYAQPQTTAPPPAAGAPGAAVSPLPSTQN
GPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIID
PQNPDESE
Download sequence
Identical sequences G3N016
ENSBTAP00000055171 ENSBTAP00000055171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]