SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055204 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055204
Domain Number 1 Region: 24-185
Classification Level Classification E-value
Superfamily EF-hand 1.82e-47
Family Penta-EF-hand proteins 0.000000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055204   Gene: ENSBTAG00000046493   Transcript: ENSBTAT00000064656
Sequence length 189
Comment pep:known chromosome:UMD3.1:20:71916825:71932650:-1 gene:ENSBTAG00000046493 transcript:ENSBTAT00000064656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAYPYRPGPGAGPAAGAALPDQSFLWNVFQRVDKDRSGVISDNELQQALSNGTWTPFNP
VTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGF
GYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQ
YLSMVFSIV
Download sequence
Identical sequences Q1LZ81
NP_001098967.1.59421 NP_001098967.1.76553 XP_004440081.1.5094 XP_005894708.1.15283 XP_006053546.1.26621 XP_020752393.1.74333 ENSBTAP00000055204 ENSBTAP00000055204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]