SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055241 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055241
Domain Number 1 Region: 1-237
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.12e-94
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055241   Gene: ENSBTAG00000047073   Transcript: ENSBTAT00000066298
Sequence length 248
Comment pep:novel chromosome:UMD3.1:16:70925149:70928253:1 gene:ENSBTAG00000047073 transcript:ENSBTAT00000066298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PANSTKNRYPHVLPYDHSRVRLALLDGKPHSDYINASFIPGYTHPQEFIATQGPLKKTLA
DFWRLVWEQQVHVIVMLTVGMENGRVLCEHYWPADSSPVTHGPVTICLLAEQPQDEWTTR
EFQLHHAAQQQLRRVKQLQFTTWPDHSVPEAPSSLLAFVELAREQARAAVGAGPLLVHCS
AGVGRSGTFVALWRLLQQLEEEQVVDAFHAVHMLRLHRPLMIQTPSQYVFLHRCLLSRVL
EGPPSSRT
Download sequence
Identical sequences G3N084
ENSBTAP00000055241 ENSBTAP00000055241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]