SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055296 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055296
Domain Number 1 Region: 117-203
Classification Level Classification E-value
Superfamily SH2 domain 1.96e-47
Family SH2 domain 0.00000425
Further Details:      
 
Domain Number 2 Region: 210-287
Classification Level Classification E-value
Superfamily RING/U-box 7.95e-43
Family RING finger domain, C3HC4 0.0000109
Further Details:      
 
Domain Number 3 Region: 32-116
Classification Level Classification E-value
Superfamily EF-hand 7.82e-37
Family EF-hand modules in multidomain proteins 0.0000106
Further Details:      
 
Domain Number 4 Region: 1-30
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 0.00000000000235
Family N-terminal domain of cbl (N-cbl) 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055296   Gene: ENSBTAG00000013057   Transcript: ENSBTAT00000062945
Sequence length 800
Comment pep:known_by_projection chromosome:UMD3.1:1:50659370:50786821:-1 gene:ENSBTAG00000013057 transcript:ENSBTAT00000062945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAEFWRKFFGDKTIVPWKVFRQ
CLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWGSILRNWNFLAVTHPG
YMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTIPHNKPLFQA
LIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQYELYCEMGSTFQLCKICAEN
DKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEPIIVDPFDPRDEGSRCCSII
DPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTSPGSSPLAQRRKPHPDPLQI
PHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQDKPLPAPPPPLRDPPPPPP
ERPPPVPPDNRLSRHFHHVESVPSRDQPMPLEAWCPRDVLGTNQSVGCRLLGDGSPKPGI
TASSNANGRHSRMGSDPVLLRKHRRNDLPLEGAKVFSNGHLGSEEYDVPPRLSPPPPAAT
LLPSIKCTGPLANSLSEKTRDPVEEDDDEYKVPSSHPVSLSSQPSHCHNVKPPPRSCDNG
HCILNGTHGTSSEMKKSNIPELGIYLKGEDAFDALPPSLPPPPPPARHSLIEHSKPPGSG
SRPSSGQDLFLLPSDPFFDPASGQVPLPPARRLPGENVKSNRASQDYDPLPSSSDGSQAP
ARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNNVEV
ARSILREFAFPPPVSPRLNL
Download sequence
Identical sequences G3N0D7
ENSBTAP00000055296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]