SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055361 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055361
Domain Number 1 Region: 49-152
Classification Level Classification E-value
Superfamily SH2 domain 5.52e-22
Family SH2 domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055361   Gene: ENSBTAG00000020828   Transcript: ENSBTAT00000065969
Sequence length 170
Comment pep:known_by_projection chromosome:UMD3.1:11:49390250:49392390:-1 gene:ENSBTAG00000020828 transcript:ENSBTAT00000065969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AYLLGPPPPSQLGPKPPRSNPQPQGYNLLLPAERRTSLSSVAATQNTSGAQEGNLLGQPW
YSGNCDRHAAESALLRCQKDGAYTVRPSSGPRGTQPFTLAVLLHGRVFNIPIRRLADGRH
YALGREGRNHEELFSSVAAMVQHYMQHPLPLLDRQSGSRQLTCLLFPTKP
Download sequence
Identical sequences G3N0J8
ENSBTAP00000055361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]