SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055444 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055444
Domain Number 1 Region: 391-558,641-809
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 7.54e-127
Family Mammalian PLC 0.000000687
Further Details:      
 
Domain Number 2 Region: 233-389
Classification Level Classification E-value
Superfamily EF-hand 8.54e-43
Family EF-hand modules in multidomain proteins 0.03
Further Details:      
 
Domain Number 3 Region: 827-943
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.13e-27
Family PLC-like (P variant) 0.00063
Further Details:      
 
Domain Number 4 Region: 106-219
Classification Level Classification E-value
Superfamily PH domain-like 5.79e-27
Family Pleckstrin-homology domain (PH domain) 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055444   Gene: ENSBTAG00000002464   Transcript: ENSBTAT00000063344
Sequence length 1482
Comment pep:known_by_projection chromosome:UMD3.1:16:51607338:51633655:-1 gene:ENSBTAG00000002464 transcript:ENSBTAT00000063344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGLAQGPSETAGDSQANARGAWEQPCGGARGQRRGRGSRGEKGAPWSSGAARHHLTHCLG
RHHRGMSVPWPLTPSRTKGTVACLAEALLWVGGSVAVSPQWQLGPLVERCMSAMQAGTQM
VKLRGSSKGLVRFYFLDEHRSCIRWRPSRKNEKAKISIDSIQEVSEGRQSEIFQRYPDGS
FDPNCCFSIYHGSHRESLDLVSPSGDEARTWVTGLRYLMAGISDEDSLARRQRTRDQWLK
QTFDEADKNGDGSLSIGEVLQLLHKLNVNLPRQRVKQMFKEADTDDHQGTLGFEEFCAFY
KMMSTRRDLYLLMLTYSNHKDHLDATDLLRFLEVEQKMTGVTLESCRDIIEQFEPCPENK
SKGAMGIDGFTNYTRSPAGDIFNPEHRLVHQDMTQPLSHYFITSSHNTYLAGDQLTSQSR
ADMYARVLQAGCRCVEVDCWDGPDGEPIVHHGYTLTSKILFKDVIETINKYAFIKNEYPV
ILSIENHCSVIQQKKMAQYLTDILGDKLDLSSVSSEDATMLPSPQVLKGKILVKGKKLPA
NISEDAEEGEVSDEDSADEIDEDCKLLNGDASTNRKRVENIAKRKLDSLMKESKIRDCED
PSDFTVSTLPPPGKLGPKAEAKKFEEDVEIGEEAGTSRRNSRLLMGSFSKRKKKSSKLKK
AASVEEGDEDLDSQGSQSRGAARQKKTMKLSRALSDLVKYTKSVGTHDVETEVASSWQVS
SFSETKAQQILQQKPAQYLRFNQHQLSRIYPSSYRVDSSNYNPQPFWNAGCQMVALNYQS
EGRMLQLNRAKFSANGSCGYVLKPQCMCQGIFNPNSEDPLPGQLKKQLVLRIISGQQLPK
PRDSMLGDRGEIIDPFVEVEVIGLPVDCNKEQTRVVDDNGFNPMWEETLVFTVHMPEIAL
VRFLVWDHDPIGRDFIGQRTLAFSSMMPGYRHVYLEGMEEASIFVHVAVSDISGKVKQAL
GLKGLFLRGPKPGSLDSHAAGRPLPRPSVSQRLLRRTASAPTKSQKPGRKAFPELVLGLQ
DTGSEGEAGDVAPSSPGPIPEAPTREEPGSRSPREPRPFSMQRSVSSLCSLETIAEEPAL
GPGPLLPGATPPSHAPGGPQCSTGLSTLSASPPRVAVEAPRPLQLQTGSHASAEPAPGSR
QWACSTGGPAGACKGAPSGHIEGKGHPRALGHVPRRAKSEGQVPSESLGGRWPLAGPCPT
VSLDATGGDRLWQRLEPGSHRGSVSSSSSLSSSDTVIELALPGLGLGLGCDSLPGTLAGR
LPLRPCSAPVACLDPPAVTKSKSNPNLRAAGQLPVGPDRLQPLPLAPGPPWRRLPLAGLP
DCTVAAKSKSLGDLTADDFAPRVESLGRGLGLAGERPAGRRVRPDALTEQLRWLTGFQQA
GDITSPTSLGPTGEGVAGAPGFLRRSSSRSQSRVRAIASRARQAQERQQRLRGPRGPPEE
ERGTPEGACSVGQEGCGDVQAPSKGATHQPLGAAATGLLLRF
Download sequence
Identical sequences G3N0S6
ENSBTAP00000055444 ENSBTAP00000055444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]