SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055481 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055481
Domain Number 1 Region: 210-309
Classification Level Classification E-value
Superfamily EF-hand 2.83e-30
Family Eps15 homology domain (EH domain) 0.0013
Further Details:      
 
Domain Number 2 Region: 1140-1213
Classification Level Classification E-value
Superfamily SH3-domain 5.51e-26
Family SH3-domain 0.0000608
Further Details:      
 
Domain Number 3 Region: 7-105
Classification Level Classification E-value
Superfamily EF-hand 1.17e-22
Family Eps15 homology domain (EH domain) 0.0015
Further Details:      
 
Domain Number 4 Region: 740-814
Classification Level Classification E-value
Superfamily SH3-domain 6.3e-20
Family SH3-domain 0.00013
Further Details:      
 
Domain Number 5 Region: 908-972
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-19
Family SH3-domain 0.0000918
Further Details:      
 
Domain Number 6 Region: 992-1055
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-19
Family SH3-domain 0.00011
Further Details:      
 
Domain Number 7 Region: 1069-1139
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-18
Family SH3-domain 0.0000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055481   Gene: ENSBTAG00000021997   Transcript: ENSBTAT00000065213
Sequence length 1215
Comment pep:known_by_projection chromosome:UMD3.1:1:998197:1114163:-1 gene:ENSBTAG00000021997 transcript:ENSBTAT00000065213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQFPTPFGGSLDIWAITVEERAKHDQQFHSLKPISGFITGNWIEKLFFQSGLPQPVLAQ
IWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAISSAPAFGMGGI
ASMPPLTAVAPVPMGSIPVVGMSPPLVSSVPAAGVPPLANGAPPVIQPLPAFAHPAATLP
KSSSFSRSGPGSQLNTKLQKAQSFDVASVPPTAEWAVPQSSRLKYRQLFNSHDKTMSGHL
TGPQARTILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFILAMHLIDVAMSGQPLPPVLP
PEYIPPSFRRVRSGSGISVITSTSVDQRLPEEPVLEDEQQQLEKKLPVTFEDKKRENFER
GNLELEKRRQALLEQQRKEQERLAQLERAEQERKERERQEQERKRQLELEKQLEKQRELE
RQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQRNKEQEDIVVLKAKKKTLEF
ELEALNDKKHQLEGKLQDIRCRLTTQRQEIESTNKSRELRIAEITHLQQQLQESQQMLGR
LIPEKQILNDQLKQVQQNSLHRDSLLTLKRALEAKELARQQLRDQLDEVEKETRSKLQEI
DIFNNQLKELREIHNKQQLQKQKSIEAERLKQKEQERKILELEKQKEEAQRRAQERDQQW
LERVHQEDEQQRPRKPHEEEKLKREESVKKKDSEEKGKPEMQDKLSRLFHQHQEPAKPAV
QAPWSTAEKGPLTISAQENIKVVYYRALYPFESRSHDEITIQPGDIVMVDESQTGEPGWL
GGELKGKTGWFPANYAEKIPENEVPAPVKPVTEAASTPTPKVAVCETPAPSSTTPAEPSE
TPNNWADFSSTWPTSTNEKPETDSWDAWATQPSLTVPSAGQLRQRSAFTPATATGSSPSP
VLGQGEKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSY
VKLISGPIRKSTSMDSGPSESPASLKRVASPAAKPAVSGEEFIAMYTYESSEQGDLTFQQ
GDVILVTKKDGDWWTGTVGDKSGVFPSNYVRLKDSEGSGTAGKTGSLGKKPEIAQVIASY
TATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLLSPGTSKITP
TDPPKPTAFPTVCQVIGMYDYTAQNDDELAFSKGQVINVLNKEDPDWWKGEVHGQVGLFP
SNYVKLTTDTDPSQQ
Download sequence
Identical sequences G3N0W1
ENSBTAP00000055481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]