SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055520 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055520
Domain Number 1 Region: 9-120
Classification Level Classification E-value
Superfamily EF-hand 3.49e-29
Family EF-hand modules in multidomain proteins 0.0045
Further Details:      
 
Domain Number 2 Region: 123-222
Classification Level Classification E-value
Superfamily EF-hand 6.39e-25
Family EF-hand modules in multidomain proteins 0.0021
Further Details:      
 
Domain Number 3 Region: 204-281
Classification Level Classification E-value
Superfamily RING/U-box 3.65e-18
Family ZZ domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055520   Gene: ENSBTAG00000046454   Transcript: ENSBTAT00000064479
Sequence length 586
Comment pep:known_by_projection chromosome:UMD3.1:2:95378114:95431378:-1 gene:ENSBTAG00000046454 transcript:ENSBTAT00000064479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLPGRKEDALNSIENSTYRTAFKLRSVQTLCQLDLIGSSLIQHVLRHQSLWEAGESTLSV
QQLFQALQEMFQKVRVEKPGQMHPRASELTLSLLTTMYDSTGTGFIKLAPAAAALITLSG
DSPLTKYTALFQLYAENNRGGHDLGARMTRRVLRNLLTDLQQIPTVVGESRALCSVESAT
RSCFQGVLSPVIKEEKFLSWLQSEPPILLWIPTCYRLSATEMATHPVRCRICRNFPITGL
RYRCLKCLNFDICQACFLSSFQGESHQKSHPVVENCIQMSAKDDTRLVLRTPRNNLLQGR
CRRKEASRRQWLLDKVNPKDMASHAQARLLKKRLNRYKDKLQAIYACQEEKSCRYDTKIH
ELTINQDSLGTKLQLMGQDLQAMLQPLHRSSFSWQNVIAKGDHGRGEERFQKRGGDSSQI
KGSTEDGSQQETLPRSTVINGSHRGPAPAKHALPNSELPEATSKPRPVQSPRAQSRAQKT
SKETSSALPSSQEGRLQDIPQIPPIEMTSLALAPVERKGAMNIQEGKDELEEEELQELLS
KLTDACTLEAPSDLQSSVNLDLYCGAERVCRAFSALVDQITLTNLK
Download sequence
Identical sequences G3N0Z8
ENSBTAP00000055520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]