SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055697 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055697
Domain Number 1 Region: 13-205
Classification Level Classification E-value
Superfamily Nudix 3.37e-30
Family MutT-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055697   Gene: ENSBTAG00000048010   Transcript: ENSBTAT00000063951
Sequence length 222
Comment pep:known chromosome:UMD3.1:21:71160886:71167980:-1 gene:ENSBTAG00000048010 transcript:ENSBTAT00000063951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERIEGVAVGRCAASPYLVPLTLHYRQNGAQKSWDFMKTHDSVTILMFNSSRRSLVLVKQ
FRPAVYAGEVERLFPGSLAAAEQDRPQALQAALPGSAGVTYELCAGLLDQPGLSLEEVAC
KEAWEECGYRLAPSDLRRVTSYKSGVGLTGSSQTMFYAEVTDAQRGSPGGGLAEEGELIE
VVHLPLDGARTFADDPDVPKTLGVIFGISWFFSCVAPGLGLQ
Download sequence
Identical sequences Q05B60
ENSBTAP00000055697 ENSBTAP00000055697 NP_001099122.1.59421 NP_001099122.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]