SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055732 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055732
Domain Number 1 Region: 3-123
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.31e-25
Family Eukaryotic proteases 0.00000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055732   Gene: ENSBTAG00000046245   Transcript: ENSBTAT00000063289
Sequence length 123
Comment pep:novel chromosome:UMD3.1:7:45034373:45034833:-1 gene:ENSBTAG00000046245 transcript:ENSBTAT00000063289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSLSXPEPSKRLYDVLRVVPHPGSRTETIDHDLLLLQLSEKAVLGPAVQLLPWQREDRDV
AAGTLCDVAGWGVVSHTGRKPDRLQHLLLPVLDRATCNLRTYHDGTITERMMCAESNRRD
TCK
Download sequence
Identical sequences G3N1I8
ENSBTAP00000055732 ENSBTAP00000055732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]