SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055780 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055780
Domain Number 1 Region: 8-159
Classification Level Classification E-value
Superfamily EF-hand 5.14e-45
Family Calmodulin-like 0.000000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055780   Gene: ENSBTAG00000045757   Transcript: ENSBTAT00000062950
Sequence length 161
Comment pep:known chromosome:UMD3.1:22:48988984:48991875:1 gene:ENSBTAG00000045757 transcript:ENSBTAT00000062950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLEELKIM
LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Download sequence
Identical sequences A0A212CA50 F6KVT2 F7C8Y6 P63315 P63317 W5P2G4
ENSSSCP00000012193 ENSECAP00000017881 NP_001029523.1.59421 NP_001029523.1.76553 NP_001123715.1.46622 NP_001272501.1.57651 XP_001493320.1.31192 XP_004018449.1.66739 XP_004661336.1.11716 XP_005898156.1.15283 XP_005959932.1.78601 XP_006044101.1.26621 XP_006196450.1.17985 XP_007116641.1.24612 XP_007174801.1.59432 XP_007451921.1.90284 XP_008511329.1.77740 XP_008570796.1.73410 XP_010850036.1.44457 XP_010967369.1.22495 XP_010983584.1.51371 XP_011977296.1.54773 XP_014724265.1.49734 XP_020729956.1.74333 XP_020827236.1.61212 ENSPCAP00000011077 ENSOARP00000004614 ENSBTAP00000055780 ENSPCAP00000011077 ENSECAP00000017881 9796.ENSECAP00000017881 9823.ENSSSCP00000012193 ENSBTAP00000055780 ENSSSCP00000012193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]