SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055802 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055802
Domain Number 1 Region: 17-254
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.42e-72
Family Eukaryotic proteases 0.0000000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055802   Gene: ENSBTAG00000048122   Transcript: ENSBTAT00000063284
Sequence length 259
Comment pep:known chromosome:UMD3.1:7:45030310:45032845:1 gene:ENSBTAG00000048122 transcript:ENSBTAT00000063284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADRSLHLVVLILLGTALCAAQPRGRILRGQEAPSHSRPYMASVQVNGKHVCGGFLIAEQ
WVMSAAHCLEDVADGKVQVLLGAHSLSQPEPSKRLYDVLRVVPHPGSRTETIDHDLLLLQ
LSEKAVLGPAVQLLPWQREDRDVAAGTLCDVAGWGVVSHTGRKPDRLQHLLLPVLDRATC
NLRTYHDGTITERMMCAESNRRDTCKGDSGGPLVCGSVAEGVVTSGSRICGNHKKPGIYT
RLASYVAWIDGVMAEGAAA
Download sequence
Identical sequences Q3T0A3
ENSBTAP00000055802 NP_001029427.1.59421 NP_001029427.1.76553 XP_005209319.1.76553 XP_010842894.1.44457 XP_010842895.1.44457 ENSBTAP00000055802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]