SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055811 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055811
Domain Number 1 Region: 150-302
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.77e-25
Family Dual specificity phosphatase-like 0.00081
Further Details:      
 
Domain Number 2 Region: 9-141
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 2.4e-23
Family Cell cycle control phosphatase, catalytic domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055811   Gene: ENSBTAG00000030999   Transcript: ENSBTAT00000065619
Sequence length 620
Comment pep:known_by_projection chromosome:UMD3.1:29:50887355:50951170:1 gene:ENSBTAG00000030999 transcript:ENSBTAT00000065619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGDRLPRKVMDAKRLASLLRGGPGGPLVIDSRSFVEYNSWHVLSSVNICCSKLVKRRLQ
QGKVTIAELIQPAARSQMEAAEPQDVVVYDQSTRDASVLAADSFLSILLSKLDGCFDSVA
ILTGGFATFSSCFPGLCEGKPATLLPMSLSQPCLPVPSVGLTRILPHLYLGSQKDVLNKV
WYPQSTCGVWLSRENTPSLPEMCRETRTRQRAPTNRFFARCLCPWMGRTENYLHKAKLSS
CQVIVHCLAGISRSATIAIAYIMKTMGMSSDDAYRFVKDRRPSISPNFNFLGQLLEYERS
LKLLAALQGDGASHPGTPEPLPGPAAPLPPPPPPPTSESAANAASREAAQTGGAEAPGPA
PATSALQQGLCGLHLSSDRLQDTNRLKRSFSLDIKSAYTPSRRPDDPGPPDPGEAPKLCK
LDSPSGGTLGLPSPSPDSPDAAPDPRPRLRRRPRPPAGSPARSPAQGLGLNFGDATRQTP
RHGLSALSAPGLPGPGQPAGPGGWAPPLDSPGTPSPDGPWCCSPEGAQGAGGARFAPFGR
AGGPGAGGGDLRRRDAARPEARDARTGWPDEPAPETQFKRRSCQMEFEEGMVEGRARGEE
LAALGKQASFSGSVEVIEVS
Download sequence
Identical sequences G3N1Q8
ENSBTAP00000055811 ENSBTAP00000055811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]