SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055894 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055894
Domain Number 1 Region: 3-82
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000031
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055894   Gene: ENSBTAG00000046484   Transcript: ENSBTAT00000063294
Sequence length 119
Comment pep:known chromosome:UMD3.1:11:101335452:101343787:1 gene:ENSBTAG00000046484 transcript:ENSBTAT00000063294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLGVPKTHLEMKKM
ISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANEGSSKPVGPPPERDIASLP
Download sequence
Identical sequences G3N1Z0
ENSBTAP00000055894 ENSBTAP00000055894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]