SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055963 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055963
Domain Number 1 Region: 19-145
Classification Level Classification E-value
Superfamily Lysozyme-like 2.23e-45
Family C-type lysozyme 0.0000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055963   Gene: ENSBTAG00000046069   Transcript: ENSBTAT00000063388
Sequence length 156
Comment pep:known chromosome:UMD3.1:X:92799368:92801705:-1 gene:ENSBTAG00000046069 transcript:ENSBTAT00000063388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVSGTIVVILMAANVEAKIYERCDLAKKLEAAGLNGFKGYTIGDWLCMAHYESGFDTSF
VNHNPDGSSEYGIFQLNSAWWCYNGVTPSENLCHMDCHELLNRHILDDIMCAKKVVSSES
GMSAWDSWNQHCYGYDLSEWLRGCHMNAKPNKKIIS
Download sequence
Identical sequences A0A077S2W3 L8HME0 Q32PD6
ENSBTAP00000055963 ENSBTAP00000055963 NP_001035626.1.59421 NP_001035626.1.76553 XP_005910597.1.15283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]