SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056067 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056067
Domain Number 1 Region: 316-409
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000327
Family Calponin-homology domain, CH-domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056067   Gene: ENSBTAG00000047410   Transcript: ENSBTAT00000065935
Sequence length 414
Comment pep:known_by_projection chromosome:UMD3.1:X:112394492:112446984:-1 gene:ENSBTAG00000047410 transcript:ENSBTAT00000065935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIHLDEQKIIVKNEKDTSSVKAESKSLLASRKTGLPSTAPSKFSDAEPAKRRLFVGMEI
IPEGLKSGKCEMPKKGNRSLKNEAKDKEFFSPKEGTRTYDFFLKTVNAAQTWFSLFGWPE
GPHSLNIPETVRRDVYKIQVYSSALSARKFSRQSDFSKYNKTIYDVLIHLCGKMPPGINS
SQSLPVDYPERVIQLHWQHSLLLDFLSAQGACISHVLPEFLLEPEDYKKWIEIRSSTTIS
AKFSHIPKGKHSVVIDMTDFEVWSKRSWTDVFLQIYKVLVLSRIVPYSINNLPPVYMQNS
PKVNAYFASSNIYSDSERILLSWMNTNYENARHVIWKNCQKGVIPPERWIVNFDKDLLDG
LVFATVLGAYCPFLIESHFINMYTQPKSSEQYLHNCLIVVNVLHEIGFDMDIQV
Download sequence
Identical sequences G3N2F5
ENSBTAP00000056067 ENSBTAP00000056067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]