SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056087 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056087
Domain Number 1 Region: 41-258
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.51e-56
Family Eukaryotic proteases 0.0000000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056087   Gene: ENSBTAG00000045829   Transcript: ENSBTAT00000063121
Sequence length 261
Comment pep:known_by_projection chromosome:UMD3.1:7:44968703:44971470:1 gene:ENSBTAG00000045829 transcript:ENSBTAT00000063121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQAWGRGTGGCWPQFPRHKAQGGTVKQPSPGHTGSAPLVDIVGGRKARPQELPFLASIQN
QGRHFCGGALIHPNFVLTAASCFQSRNTGIATVVLGAYDLRRRERSRQTFFIRSVSENGY
DPQQNLNDVLLLQQLDRQANLTSSVALVPLPEQNATVEAGTGCQVAGWGTRRRRGRLSRV
PRVLNVTVTPANQCRPNNVCTGVLTRRGGICQGDGGTPLVCNGLAHGVASWSRGPCGRGT
DFFARVALFRNWIDSVINQPA
Download sequence
Identical sequences G3N2H4
ENSBTAP00000056087 ENSBTAP00000056087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]