SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056127 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056127
Domain Number 1 Region: 87-239
Classification Level Classification E-value
Superfamily EF-hand 8.65e-27
Family Calmodulin-like 0.018
Further Details:      
 
Domain Number 2 Region: 2-111
Classification Level Classification E-value
Superfamily EF-hand 6.93e-16
Family Calmodulin-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056127   Gene: ENSBTAG00000047362   Transcript: ENSBTAT00000063521
Sequence length 246
Comment pep:known chromosome:UMD3.1:15:63656459:63663593:1 gene:ENSBTAG00000047362 transcript:ENSBTAT00000063521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KIVDRIDSDGDGFVTTEELKTWIKRVQKRYIYDNVAKVWKDYDRDKDDKISWEEYKQATY
GYYLGNPTEFQDTSDHHTFKKMLPRDERRFKAADLDSDQTATREEFTAFLHPEEFEHMKE
IVVLETLEDIDKNGDGFVDQDEYIADMFSHEESGPEPDWVLSEREQFNEFRDLNKDGKLD
KDEISHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILDNWNMFVGSQATNYGEDLT
KNHDEL
Download sequence
Identical sequences G3N2L2
ENSBTAP00000056127 ENSBTAP00000056127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]