SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056150 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056150
Domain Number 1 Region: 306-413
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-26
Family SH2 domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056150   Gene: ENSBTAG00000003910   Transcript: ENSBTAT00000064359
Sequence length 443
Comment pep:known_by_projection chromosome:UMD3.1:28:36127031:36212116:1 gene:ENSBTAG00000003910 transcript:ENSBTAT00000064359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQQILHDMYIDPELLAELSDVQKHILFYKMREEQLRRWREREAWEALAQVEGLRPPKAA
SDKHIQWLLGADGEVWVWIMGEGPGDKPYEEISEELIAERARLQAQREAEELWKQKEAEI
TKKFRDALANEKARILAEKWKVEMEDRKAAKVLEERIHEEFKGRGPSRNPAQRQKMPHKE
RKEEEERKRGEEQIRLQEEQRAKELYWTLKQAQLQSHPSEKEEREWEEQLRRSKAADEER
SRRAQRARDEYQRHSLRAIQKGTVAGLSSRFPPSPSFLPRPCPLPRDSPTLCGLCLSRTW
ERPLRPVSREVIVRWFKEEQLPRRAGFERNTKAIAPWFHGIISREDAEDLLENMTEGAFL
VRVSEKIWGYTLSYRLQKGFKHFLVDASGDFYSFLGVDPNRHATLTDLIDFHKEEIITVS
GGELLQEPCGQRDSPPDYHLLFE
Download sequence
Identical sequences G3N2N3
ENSBTAP00000056150 ENSBTAP00000056150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]