SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056273 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056273
Domain Number 1 Region: 321-611
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.2e-76
Family Protein kinases, catalytic subunit 0.000000285
Further Details:      
 
Domain Number 2 Region: 165-248
Classification Level Classification E-value
Superfamily Kringle-like 2.69e-34
Family Kringle modules 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056273   Gene: ENSBTAG00000012312   Transcript: ENSBTAT00000064040
Sequence length 791
Comment pep:known_by_projection chromosome:UMD3.1:3:81672081:81712977:-1 gene:ENSBTAG00000012312 transcript:ENSBTAT00000064040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPAAKIKVFSPTFKDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAF
TMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIF
ARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVS
VTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENYKFDLC
DIPACDSKDSKEKNKMEILYILVPSVAIPLAIALLFFFICVCRNNQKSSSPPVQRQPKHV
RGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELGECAFGKIYKGHLYLPGMDHAQLVAIK
TLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLGAVTQEQPVCMLFEYMNQGDLHEFLIM
RSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIAAGMEYLSSHFFVHKDLAARNILIGEQ
LHVKISDLGLSREIYSADYYRVQSKSLLPIRWMPPEAIMYGKFSSDSDIWSFGVVLWEIF
SFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPRMYSLMTECWNEIPSRRPRFKDIHVRL
RSWEGLSSHTSSTTPSGGNATTQTTSLSASPVSNLSNPRYPNYMFPSQGITPQGQIAGFI
SPPIPQNQRFIPINGYPIPPGYAAFPAAHYQPAGPPRVIQHCPPPKSRSPSSASGSTSTG
HVTSLPSSGSNQEANIPLLPHMSIPNHPSGMGITVFGNKSQKPYKIDSKQPSLLGDPNIH
GHTESMISAEL
Download sequence
Identical sequences G3N302
ENSBTAP00000056273 ENSBTAP00000056273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]