SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056320 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056320
Domain Number 1 Region: 2-152
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000591
Family Calmodulin-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056320   Gene: ENSBTAG00000046338   Transcript: ENSBTAT00000064719
Sequence length 254
Comment pep:known_by_projection scaffold:UMD3.1:GJ060120.1:1009:8398:1 gene:ENSBTAG00000046338 transcript:ENSBTAT00000064719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CKFWELDTDHDLLIDAQDLARHNDHAISTKMIDRIFSGAVTRGKKVQKEGKISYADFVWF
LISEEDKKTPTSIEYWFRMDLDGDVALFMFELEYFYEEQSRRLDSMAIEALPFEDCMCQM
LDLVKPQTEGRITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQASLLRESDSEGPELSD
WERFAAEEYDILVAEEAAGDPWEDGYEAELSPMEQKLSALRSPLAQRPFLEAPGSLGAVE
LYEYECGDDDLPPS
Download sequence
Identical sequences H9GW44
ENSBTAP00000056320 ENSBTAP00000056320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]