SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056427 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056427
Domain Number 1 Region: 938-1040
Classification Level Classification E-value
Superfamily SRCR-like 6.28e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 2 Region: 376-482
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000684
Further Details:      
 
Domain Number 3 Region: 695-802
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000672
Further Details:      
 
Domain Number 4 Region: 1163-1266
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000095
Further Details:      
 
Domain Number 5 Region: 1044-1147
Classification Level Classification E-value
Superfamily SRCR-like 7.32e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000488
Further Details:      
 
Domain Number 6 Region: 589-694
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000696
Further Details:      
 
Domain Number 7 Region: 23-129
Classification Level Classification E-value
Superfamily SRCR-like 4.05e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00024
Further Details:      
 
Domain Number 8 Region: 236-344
Classification Level Classification E-value
Superfamily SRCR-like 6.02e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00019
Further Details:      
 
Domain Number 9 Region: 130-235
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00021
Further Details:      
 
Domain Number 10 Region: 801-902
Classification Level Classification E-value
Superfamily SRCR-like 3.92e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00027
Further Details:      
 
Domain Number 11 Region: 523-586
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000236
Family Spermadhesin, CUB domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056427   Gene: ENSBTAG00000039755   Transcript: ENSBTAT00000066099
Sequence length 1266
Comment pep:novel chromosome:UMD3.1:26:42929978:42986894:1 gene:ENSBTAG00000039755 transcript:ENSBTAT00000066099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARQRASSIGKSHELTLTFSPAGDWPTLRLVNGPGRCSGRVEVSYQGSWGSVCGKGWGLKE
AHVVCRQLGCGWAVSTPPGAHFSPGFGKILLDNVHCSGEESHLALCAHDTWFTHSCGHEA
DAGAICSGAWVAVRLVGGPGRCSGRVEVLVQDTWGTVCDDFWDLAEAAVVCRQLECGQAV
VAPTGAHVGVGSGKIVLDNMQCVGSKSHLEQCMHGGEAGHNCGHQEDASVICTGAWVAVK
LVGGPGRCSGRVEVLVQDTWGTVCDDLWDLAEAAVVCRQLECGQAVAAPTGAHFGAGSGK
IALDNLQCVGSESHLGQCVHGGEAGHNCGHLEDASVICAGERLLFCPTGADSTAAPATGR
ARVMSSARLCMINLRGWAPVRLVGGHGSCAGRVEVFYQGAWGTVCDSLWDLPEANVVCRQ
LGCGRAMEAPGKAHFGEGSGKVLLDNMQCRGHEEHLDECSHAGWFAHNCGHREDAGVVCS
ERKESRMFFTDSRCFYLSHLQMLNTQWPCYQPLQFTVHFTLRKSQCGRIITNSSGAIRNP
PRNKMHDNITCVWEIRANASDHIRLAFPYLNAPCSVRFQTFISLVDSWDWPELRLVGGSG
RCSGRVEVLHEEAWGTVCDDLWDLNEAEVVCRQLGCGQAVSALGKAHFGPGSGDIFLDNL
QCAGAERHLGQCAHSGWSEHNCGHHEDAGVICSGDWPELRLVGGSGRCSGRVEVLHEGAW
GTVCDDLWDLNEAEVVCRQLGCGRAVSALGKAHFGPGSGDIFLDNLQCAGAERHLGQCAH
SGWSEHNCGHHEDAGVICSDEPELQMVGSSEQCSGRVEILHQGAWGTVCDDLWDLNKAGV
MCWQLGCGRAITAPGKTHFSPGSGDILLDNLQSLGIESHLGQCPSSGWSDPNCGHHEDAG
VIYSVGEDPMSIPEAIMEGTPAGVTHSGDSAFPSPGESLRLGNGSHRCEGRVEVSYNGTW
GTVCDDSWDLTDARVVCQQLGCGEALSAPKQSYFGGGTGHIILDNVQCVGNEAKVWQCPH
SGWFSHNCGHHEDAGVVCSANAMLRLADGSPPCEGRVELHFNGSWGTVCDDSWDLQDAEV
VCRQLSCGGAVSAPGRARFGRGLGPIALDDVRCVGTEARLWQCLHGGWFSHNCGHHEDAG
VVCSASLPYSTPSAAVGHPTSGLGLRLADGSNRCEGRVEVCHADTWGTVCDDSWSIEDAH
VVCKQLGCGRAMSALPGARFSPGAGSILLDDVNCTGSESSLAQCPHSGWFTHNCGHHEDA
GVVCSG
Download sequence
Identical sequences G3N3C5
ENSBTAP00000056427 ENSBTAP00000056427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]