SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056472 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056472
Domain Number 1 Region: 120-216
Classification Level Classification E-value
Superfamily Immunoglobulin 4.03e-24
Family I set domains 0.00081
Further Details:      
 
Domain Number 2 Region: 26-118
Classification Level Classification E-value
Superfamily Immunoglobulin 4.43e-16
Family I set domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056472   Gene: ENSBTAG00000045854   Transcript: ENSBTAT00000064016
Sequence length 272
Comment pep:novel chromosome:UMD3.1:18:62895516:62898446:1 gene:ENSBTAG00000045854 transcript:ENSBTAT00000064016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVVPPSLLCLGLCLSQSTCAQKGNLPPPRITALPGSVPWKRPVTLLCQGPKQAEGYRIS
RVGSPEPMDKDEQITPRKTNTLNIAEVTTDKTGLYHCSYQRGGHWSQFSDPLQLVITGAY
DKPSLSSIAGTVVAPGENVKLQCFSKINHDVFILTKEDGDHVTQNQSSVPHDGGRQTIFL
LNPVSSTQAGTYRCYGAFHEYPYVWSQPSDPLQLQVEAPMAWHPSVETQVRLSLAALLLL
VMVVLLAEAWCSRGGPSVKSDEPPPQWTDKHR
Download sequence
Identical sequences G5E6Q9
ENSBTAP00000056472 ENSBTAP00000056472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]