SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056605 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056605
Domain Number 1 Region: 1-275
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.52e-57
Family Bacterial PLC 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056605   Gene: ENSBTAG00000035144   Transcript: ENSBTAT00000066297
Sequence length 281
Comment pep:known scaffold:UMD3.1:GJ060118.1:1942:8662:1 gene:ENSBTAG00000035144 transcript:ENSBTAT00000066297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSHDTMTYCLNKKSPISSKEPRLLHLLCKVLPCVTLPMVLKWSTTQVLSVTEQLDAGVRY
LDLRIAHVEDGSERNLHFVHMVYTTALVEDTLTEISEWLQSHPREVVILACRNFEGMTED
LHEYLVGCIKNIFGDMLCPRGEVPTLRQLWSRGQQVILSYEDEAPVSRHTELWPGIPYWW
GNKVKPQDLVNYLELMKSHGRPGGLFVAGINLTENLEFILVHPAWSLEKLTLSGLPYLCA
WVRAQCPGSAAGCTNIIAGDFIGASGFVSDVIGLNQKLLRG
Download sequence
Identical sequences H9GW45
ENSBTAP00000056605 ENSBTAP00000056605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]