SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000056620 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000056620
Domain Number 1 Region: 12-74
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000981
Family RING finger domain, C3HC4 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000056620   Gene: ENSBTAG00000045884   Transcript: ENSBTAT00000064601
Sequence length 249
Comment pep:known chromosome:UMD3.1:23:42467107:42467856:-1 gene:ENSBTAG00000045884 transcript:ENSBTAT00000064601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASQLPEEAAKSQVSDELECKICYNRYNLKQRKPKVLGCCHRVCAKCLCKIINFGDTPHG
VIVCPFCRFETCLPDDEVSSLPDDNNILLNLTCGGGKGKKCLPENPTELLLTPKRLASLV
SPSHASSNCLVITIMEVQRESSPSLSSTPVVEFYRPSSFDSVTTAVSHNWTMWNCTSLVF
QTSIRVLVWLLGLLYFSSLPLGIYLLVSKKVTLGVVFVSLVPSSLVILMVYGFCQCVCHE
FLDCLAPSS
Download sequence
Identical sequences G3N3V7
9913.ENSBTAP00000023773 ENSBTAP00000056620 ENSBTAP00000056620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]