SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000401 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000401
Domain Number 1 Region: 344-672
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.26e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000135
Further Details:      
 
Domain Number 2 Region: 635-932
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.86e-80
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000145
Further Details:      
 
Domain Number 3 Region: 29-112,157-193
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000012
Family Fibronectin type III 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000401   Gene: ENSBTAG00000000309   Transcript: ENSBTAT00000000401
Sequence length 933
Comment pep:known_by_projection chromosome:UMD3.1:13:71397829:71678072:-1 gene:ENSBTAG00000000309 transcript:ENSBTAT00000000401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAQINYKAVGSLDPNADLSSQRGKVFKLRNETHHLFVGLYPGTTYSFTIKASTAKGFGPP
VTTRIATKISAPSMPEYDTDTPLNETDTTITVMLKPAQSRGAPVSVYQLVVKEERLQKSR
RAADIIECFSVPVSYRNASSLDSLHYFAAELKPANLPVTQPFTVGDNKTYNGYWNPPLSP
LKSYSIYFQALSKANGETKINCVRLATKGASTQNSNTVEPEKQVDNTVKMAGVIAGLLMF
TIILLGVMLTIKRRKLAKKQKETQSGAQREMGPVASADKPTAKLSSSRNDEGFSSSSQDV
NGFDGSRGELAQPTLTIQTHPYRACDPVEMSYPRDQFQPAIRVADLLQHITQMKRGQGYG
FKEEYEALPEGQTASWDTAKEDENRNKNRYGNIISYDHSRVRLLVLDGDPHSDYINANYI
DGYHRPRHYIATQGPMQETVKDFWRMIWQENSASIVMVTNLVEVGRHPAGHTVGNATLGR
AASPGMVKCVRYWPDDTEVYGDIKVTLIETEPLAEYVIRTFTVQKKGYHEIRELRLFHFT
SWPDHGVPCYATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTMLDMAENEG
VVDIFNCVRELRAQRVNLVQTEEQYVFVHDAILEACLCGNTAIPVCEFRSLYYNISRLDP
QTNSSQIKDEFQTLNIVTPRVRPEDCSIGLLPRNHDKNRSMDVLPLDRCLPFLISVDGES
SNYINAALMDSHKQPAAFVVTQHPLPNTVADFWRLVFDYNCSSVVMLNELDTAQLCMQYW
PEKTSGCYGPIQVEFVSADIDEDIIHRIFRICNMARPQDGYRIVQHLQYIGWPAYRDTPP
SKRSLLKVVRRLEKWQEQCDGREGRAVVHCLNGGGRSGTFCAICSVCEMIQQQNIIDVFH
IVKTLRNNKANMVETLDQYKFVYEVALEYLSSF
Download sequence
Identical sequences E1BDH9
ENSBTAP00000000401 ENSBTAP00000000401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]