SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000000691 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000000691
Domain Number 1 Region: 227-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.67e-22
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 2 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.52e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 2-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 4 Region: 329-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-19
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 5 Region: 171-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-16
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 6 Region: 133-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000971
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000000691   Gene: ENSBTAG00000000533   Transcript: ENSBTAT00000000691
Sequence length 382
Comment pep:known_by_projection chromosome:UMD3.1:3:106216832:106226043:-1 gene:ENSBTAG00000000533 transcript:ENSBTAT00000000691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MINFKGSVTLQDVAVEFTPEEWQLLDCDQRTLYWDVMLENFRNLISVGTGCPVTETTVIF
KVEQGQGPWMVEGENSRWSSPEADCPLVDESDKHQKSKDNFLNSILFMFDKILTVERLHG
YNMSTSLNPTRKKSYKCKSYGKSLQPTLDFHNYNRCYNGEHADECNECGKAFKKKFNFIR
REKNHTRKKLFECNNCGKAYSSKAHLATHQKIHNRERPFVCSDCGKAFTHKAQLVVHQRL
HTGEKPYECSQCGKSFTWNSSFNQHMKSHTLENSFECKECGKTFRYSSSLYKHSKFHTGE
KPYQCIVCGKAFGNSSVLVTHQRIHTGEKPYGCIKCGKAFIKKSHLLRHQITHTGERPYE
CSKCGKPFSQKSNLIVHQKIHM
Download sequence
Identical sequences F1MR89
XP_005204863.1.76553 XP_005204864.1.76553 XP_015318315.1.59421 XP_015318316.1.59421 ENSBTAP00000000691 ENSBTAP00000000691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]