SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000001599 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000001599
Domain Number 1 Region: 1145-1243
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-24
Family Pleckstrin-homology domain (PH domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000001599   Gene: ENSBTAG00000001209   Transcript: ENSBTAT00000001599
Sequence length 1254
Comment pep:known_by_projection chromosome:UMD3.1:1:57054879:57145880:1 gene:ENSBTAG00000001209 transcript:ENSBTAT00000001599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQSHMQKQLDLQNGSLEAGFAENSLENDSQNMMESLSPKKYSSSLRFKANGDCSGSYL
TLSQPVPAKRSPSPLGTSVRSSPSLAKIQGTKQFSCDGSEKSISMKPPTPLRSTSPSLSG
YALGRADFDHFLGRDAERSLRLSEKPPYSKYSSRNKSHDNVYFLGGLEGRKASGSLLTMW
NGSSLSDTGSSPINRSGAASMPSSPKQARKISIQDNLTLQPKLSRHRDPASENISLRTRK
YSSGSLSHMGAYSRSLPRLHRATENQLAPLSLPPRSSLGNSKRTKLGEKDLPHCIIDNDN
YLNFSSLSSGALPYKASASEGSAYVSSTLSVPASPRVARKMLLASTSSCTSDDLDRASYS
GTSPGHSFPPGELDRAFAARRNFSCGSVEFDDADLDSLRQASGTPQPVLRERKSSISSIS
GRDDLMDYHRRQREERLREQEMERLERQRLETILSLCAEYTKPDSRVSPGTTVADVQKIN
KELEKLQLSDEESVFEEALVSPDTRYRCHQKSALHDADLAGFGSLSQSSASFLPPRGARN
DELLGDLARTPPPPSSAFLKASGESAYLSILPKTPEGISEEQRIQELTAMEETRIAILNN
LEELEQKIKDINDQMEESSRELDMECALLDGEQKSETTELMKEKEILDHLNRKITELEKN
IVGEKTKEKVKLDAEREKLERLQELYSEQKTQLDNCPESMREQLQQQLKRDADLLDVESK
HFEDLEFQQLERESRLDEEKENLTQQLLREVAEYQRNIVTRKEKISALKKQANHIVQQAQ
REQDHFVKEKNNLIMMLQREKENLCNLEKKYSSLSGGKGFPVTPNTLKEGYIIVNEINES
CGSSTNLPPSTQFPADADATAAGPTTAVLMSQPQSKEHFRSLEERKKQHQEGLYLSDTLP
RKKTTPSISPHFSSATMGRSTTPKGHLPLGQSNSCGSVLPHSLATMTKDSESRRMLRGYN
HQQMSEGQRQKSSEFYNRTASESNVYLNSFHYPDHSYKDQAFDTLSLDSSDSMETSISAC
SPDNISSASTSNIARIEEMERLLKQAHAEKTRLLESREREMEAKKRALEEEKRRRELLEK
RLQEETSQRQKLIEKEVKIREKQRAQARPLTRYLPVRKEDFDLRSHVETAGHNIDTCYHV
SITEKTCRGFLIKMGGKIKTWKKRWFVFDRNKRTFSYYADKHEAKLKGVIYFQAIEEVYY
DHLKNANKSPNPLLTFSVKTHDRIYYMVAPSPEAMRIWMDVIVTGAEGYTHFLL
Download sequence
Identical sequences E1BBH1
ENSBTAP00000001599 9913.ENSBTAP00000001599 ENSBTAP00000001599 NP_001193237.1.59421 NP_001193237.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]