SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000002533 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000002533
Domain Number 1 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.36e-26
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 8-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 5 Region: 363-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-21
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 174-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.4e-18
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000002533   Gene: ENSBTAG00000001949   Transcript: ENSBTAT00000002533
Sequence length 425
Comment pep:known chromosome:UMD3.1:11:1953347:1958756:1 gene:ENSBTAG00000001949 transcript:ENSBTAT00000002533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVSPTRCQDPVTFEDVAVVFTDEEWRRLVPTQRDLYKEVMLENYKSIVSLGLPVPGPD
VIFQLKRGDEPWLVEFHGFEGKEGAENVSLDWETKPEIQGASEEEKSEGSLKENLGRKGP
PSPKVEVYVLDGRLGTEKESLTVEACKKPPSLEESLRHRATPPKKFLTKERDQECSNCGK
TFFDHSSLIRHQRTHTGEKPYDCPECGKAFSHRSSLSRHLMSHTGESPYECNACGKAFFD
RSSLTVHQRIHTGEKPFKCSECGKAFFDRSSLTRHQRIHTGESPYECNQCGKAFSQKSIL
TRHQLIHTGRKPYECNECGKAFYGVSSLNRHQKAHAGEPRYQCSECGKAFFDRSSLTQHQ
KIHTGDKPYECSECGKAFSQRCRLTRHQRVHTGEKPFECSVCGKVFSSKSSVIQHQRRYA
KQGID
Download sequence
Identical sequences F1N1Y9
ENSBTAP00000002533 XP_010808051.1.76553 XP_019825204.1.53367 ENSBTAP00000049777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]