SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003027 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003027
Domain Number 1 Region: 1567-1707
Classification Level Classification E-value
Superfamily SET domain 1.11e-43
Family Histone lysine methyltransferases 0.0046
Further Details:      
 
Domain Number 2 Region: 68-168
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000631
Family Canonical RBD 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003027   Gene: ENSBTAG00000002345   Transcript: ENSBTAT00000003027
Sequence length 1710
Comment pep:known_by_projection chromosome:UMD3.1:25:27352589:27374486:1 gene:ENSBTAG00000002345 transcript:ENSBTAT00000003027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQEGGGDGQKAPSFQWRNYKLIVDPALDPALRRPSQKVYRYDGIHFSVNDSKYIPVEDL
QDPRCHVRSKNRDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEV
EEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYY
ELIVNGSYTPQTVPTGGKALSEKFQGSGAATETTDSRRRSSSDTAAFPAGSAVVGTPGNG
TPCSQDTSFSSSRQDTPSSFGQFTPQSSQGTPYTSRGSTPYSQDSAYSSSTTSTSFKPRR
SENSYQDSFSRRHFSASSAPTTTSAAICATTAATASASSSSSLSSSSSSSSSSSSSHFRG
SDSNYPAYYESWNRYQRHASYPPRRATRDEPPGASFAENTAERFTPSYTSYLPPEPNRPA
DQDYRPPASEAPPPEPPEPGGGGGGGGPSPEREEARTSPRPASPARSGSPAPETTNESVP
FAQHSSLDSRIEMLLKEQRSKFSFLASDTEEEEENSSTGPGARDTGSEAPSGSGHGPCTP
PPAPASFEDVAPTGSGEPGATRESPKANGQNQASPCSSGEDMEISDDDRGGSPPPAPTPP
QQPPPPPPPPPPPPPYLASLPLGYPPHQPAYLLPPRPDGPPPPEYPPPPPPPPHIYDFVN
SLELMDRLGAQWGGMPMSFQMQTQMLTRLHQLRQGKGLTAASAGPPGGAFGEAFLPFPPH
QEAAYGLPYALYAQGQEGRGAYSREAYHLPLPMAAEPLPSSVSGEEARLPPREEAELAEG
KALPSAGTVGRVLATLVQEMKSIMQRDLNRKMVENVAFGAFDQWWESKEEKAKPFQNAAK
QQAKEEDKEKTKLKEPGLLSLVDWAKSGGTTGIEAFAFGSGLRGALRLPSFKVKRKEPSE
ISEASEEKRPRPSTPAEEDEDDLDAEREKEVGEPGRPGTKPPKRDEERSKTQGKHRKSFA
LDSEGEEASQESSSEKDEEDEEEDEEDEEREEAMDAAKKETEASDGEDGESDSSSKCSLY
ADSDGENDSTSDSESSGSSSSSSSSSSSSSSSSSSSSSESSSEEEEEEEQPAIILAALSP
PRDVPTPLSAPAEEPEPERVEDSPVTPLPEQEKSPVRPAGSTEEPPSSAPQPPPEPPAGP
LAPIPRPDDRPSSPIPLLPPPKKRRKTVSFSAVEEAPAPEPPPAALPQAKSSGPASRKAP
RAVERTIRNLPLDHASLVKSWPEEVSRGGRNRAGGRGRSAEEEEAEPATEVDLAVLADLA
LTPARRGLPALPAADDSEAAETPDEAERPGPLLSHILLEHNYALAVRPPLPPPPPPSTPA
PRPLEPVPAPAALFSSPADEVLEAPEVVVAEVEEPKQPPQQQEDGEEEEEEEEESESSES
SSSSSSDGEGATRRRSLRSHTRRRRPPPPPPPPPPPTFDPRSEFEQMTILYDIWNSGLDL
EDMSYLRLTYERLLQQTSGADWLNDTHWVQHTITNLSTPKRKRRPQDGPREHQTGSARSE
GYYPISKKEKDRYLDVCPVSARQLEGVDTQGTNRVLSERRSEQRRLLSAIGTSAIMDSDL
LKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMREKRYVQE
GIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVD
EEITYDYKFPLEDNKIPCLCGTESCRGSLN
Download sequence
Identical sequences E1BLX2
ENSBTAP00000003027 ENSBTAP00000003027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]