SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003163 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003163
Domain Number 1 Region: 126-408
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.31e-110
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000274
Further Details:      
 
Domain Number 2 Region: 411-703
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.57e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003163   Gene: ENSBTAG00000002435   Transcript: ENSBTAT00000003163
Sequence length 713
Comment pep:known chromosome:UMD3.1:26:47801368:47842727:1 gene:ENSBTAG00000002435 transcript:ENSBTAT00000003163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PASSRVAMEPFCPFLLAGVSLPLAKALKGNETTTTTTPTAQSNWTSTTAGPPAPGAPQPL
LAWLLLPLLVFLLFLLLAAYFFRFRKQRKAVVSANDKKMPNGILEEQEQQRVMLLSRSPS
GPKKYFPIPVAHLEDEIRARSADDCKRFREEFNSLPSGHVQGTFELANKEENREKNRYPN
ILPNDHSRVILSQVDGTPCSDYINASYIDGYKEKNKFIAAQGPKQETVNDFRRMIWEQKC
ATIVMLTNLKERKEEKCYQYWPDQGCWTYGNIRVCVEDCAVLVDYTIRKFCIQSQLPDGC
KAPRLVCQLHFTSWPDFGVPFTPIGMLKFLKKVRTLNPAHAGPIVVHCSAGVGRTGTFIV
IDAMMDMVHAEQKVDVFDFVSRIRNQRPQMVQTDMQYTFIYQALLEYYLYGDTELDVSSL
EKHLQALHGPTAHFDKIGLEEEFRKLTNVRIMKENMRTGNLPANMKKARVIQIIPYDFNR
VILSMKRGQEYTDYINASFIDGYRQKDYFIATQGPLAHTVEDFWRMVWEWKCHTIVMLTE
VQEREQDKCYQYWPTEGSVTHGEITIEIKSDTLSEAISIRDFLVTFNQPLARPEEQTRVV
RQFHFHGWPEIGIPAEGKGMIDLIAAVQKQQQQTGNHPITVHCSAGAGRTGTFIALSNIL
ERVKAEGLLDVFQAVKSLRLQRPHMVQTLEQYEFCYKVVQDFIDIFSDYANFK
Download sequence
Identical sequences F1MP45
ENSBTAP00000003163 ENSBTAP00000003163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]