SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000003993 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000003993
Domain Number 1 Region: 42-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.15e-36
Family SCAN domain 0.0000449
Further Details:      
 
Domain Number 2 Region: 381-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 426-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-21
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 329-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-20
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 5 Region: 286-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000056
Family Classic zinc finger, C2H2 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000003993   Gene: ENSBTAG00000031874   Transcript: ENSBTAT00000003993
Sequence length 485
Comment pep:known chromosome:UMD3.1:23:30332529:30343084:-1 gene:ENSBTAG00000031874 transcript:ENSBTAT00000003993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATESKKATAQNLQEDEGLLIVKMEEEDFVWRQGACLQRNDPLRQELCRRLFRQFCYQDS
PGPRDALSQLRQLCCQWLKPETQTKEQILELLILEQFLAILPGDLQAWVRERYPESGEEA
VTLLEDLERGTDEAVLQIPVCGHGQEPFRRKVASPGPALSVPFQPVDTTALHGSSEPQLL
LDCDNKSENSESMPKLDIYEKMESQKIVSGRISEFVSEGSAEPQDICKSAGKIKRQQEKD
SGESQKSSSAQDAAFSKILTHKNTLRGEIISHDGCERNLNLNSNEFTHQKSCKHSTCDQS
FKWNSDFIKHQRIYAGEKIHPYGKSLKNPNLIKHAAVFTGEKTHQCNECGKAFRHSSKLI
RHQRIHTGERPYECNECGKGFGGSSDLIRHQRIHTGERPFECKECGRAFSLNSHLILHQR
IHTREKPYECSECGKTFRVSSHLIRHLRTHTGEKPYECSECGRAFSQSSHLSQHQRIHKR
ENLFM
Download sequence
Identical sequences F1MBI0
ENSBTAP00000003993 9913.ENSBTAP00000003993 ENSBTAP00000003993 NP_001178305.1.59421 NP_001178305.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]