SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004101 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004101
Domain Number 1 Region: 871-1145
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.24e-67
Family Protein kinases, catalytic subunit 0.00000861
Further Details:      
 
Domain Number 2 Region: 564-850
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-48
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 3 Region: 434-545,575-600
Classification Level Classification E-value
Superfamily SH2 domain 1.11e-16
Family SH2 domain 0.0039
Further Details:      
 
Domain Number 4 Region: 147-280
Classification Level Classification E-value
Superfamily Second domain of FERM 7.22e-16
Family Second domain of FERM 0.0039
Further Details:      
 
Domain Number 5 Region: 365-425
Classification Level Classification E-value
Superfamily PH domain-like 0.00000112
Family Third domain of FERM 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004101   Gene: ENSBTAG00000003147   Transcript: ENSBTAT00000004101
Sequence length 1158
Comment pep:known chromosome:UMD3.1:3:80861479:80915019:1 gene:ENSBTAG00000003147 transcript:ENSBTAT00000004101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQYLNIKEDCSAMAFCAKMRSSKKAEMNLEAPEPGVEVLFYLSDREPLRLGGGEYTAEEL
CIRAAQECCISPLCHNLFALYDENTKLWYAPNRTVTVDDKTSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
RFHPNDSGNVLCYEVMVTGNLGIQWRQKPHIVPVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEVLGIQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYTMSQLSFDRILKKDITQGEHLGRGTRTHIYSGT
LTDYKDDEGTSEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSEKKPTTEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSD
SSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQHMRKCWEFQPSNRTT
FQNLIEGFEALLRSMSNI
Download sequence
Identical sequences F1N0D6
ENSBTAP00000004101 ENSBTAP00000004101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]