SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004335 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004335
Domain Number 1 Region: 47-203
Classification Level Classification E-value
Superfamily L domain-like 5.44e-30
Family Internalin LRR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004335   Gene: ENSBTAG00000003338   Transcript: ENSBTAT00000004335
Sequence length 1030
Comment pep:known chromosome:UMD3.1:14:79805242:79848868:-1 gene:ENSBTAG00000003338 transcript:ENSBTAT00000004335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGAMEAPGEAEVENEDGDSNCGDLCFMDKGLRSISELSLDSALHAINLHCNNISKITSID
HVWNLQHLDLSSNQISQIEGLNTLTKLCTLNLSCNLITRIEGLEALSNLTRLNLSYNHIN
DLSGLMPLHGIKHKLRYIDLHSNCIDSIHHLLQCTVGLHFLTNLILEKNGEDNPVCHLPG
YRAVMLQTLPQLRILDCKNIFGEPINMAEINSSHLQCFEGLLDNLVSSESPLNISEDEIT
DGMPVAPPVGDTVPLDQFPSTPTDTGLTSLMSVCPSSEPEKVNHENDLQNEMKLQKLDDQ
ILQLLSETSNSIIDNVPEKDPRPKRDTDVTSESDYGNRKECSKKTSRRSKIPYYSKTIQT
IKHHSKNSSTFISCNRKMKPPFLKELYISSSLPNNSTLEESENQKTEIMKVNNDCPEDAT
YRALVEELDEEREKRWKAEQTEKKLMDYIDELHKHADEKKDIRSQALLTTDRLKEIIFKE
RNSKLQLEIMVHRLQNEIKKLTIELIKARDQQDDHIRHLRTLEKALEKMERQKGQQQAAQ
MRLIQEVELKAAAADREINLLRTSLHQEKEQGAQLHELLALKEKEHRKDIETREFFSEAE
FQEALAKEIAKEERKHEQVIKEYQDKIDALNQQYMDLENEFRIALTVEARRFKDVKDGFE
NVATELAKSKHALVWAQRKENESSSLIKDLTCMVKEQKTKLAEVSKLKQETAANLQNQIN
TLEILIEDDKQKSIQIELLKQEKMQLISELAAKESLIYGLRTERKVWGHELALQGSSLVQ
NHGRVEAQLESLYRENECLRKASERDSDTIRIKCKIIDDQTETIGKLKECLQEREEQIKI
LHEKITEIQKCTQEQLEEKSSQLDEIVEKLERHNERKEKLKQQLKVKELELDEIRKAYST
LNQKWHDKGELLCHLEMQVKEVKENFENKERKLKAERDKSIELQKDAMEKLQSMDDAFKK
QVDAIVEAHQNEIIQLANEKQKCIDSANLKVHRVEEEMRGLLEETCKNKKAMETKIKQLA
FALSQIQQEI
Download sequence
Identical sequences F1MZ78
ENSBTAP00000004335 ENSBTAP00000004335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]