SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004686 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004686
Domain Number 1 Region: 44-79
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000109
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 970-1021
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000249
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 3 Region: 778-836
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000432
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 4 Region: 908-966
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000981
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 5 Region: 720-778
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000196
Family TSP-1 type 1 repeat 0.007
Further Details:      
 
Domain Number 6 Region: 840-904
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000863
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 7 Region: 663-718
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000085
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004686   Gene: ENSBTAG00000003604   Transcript: ENSBTAT00000004686
Sequence length 1070
Comment pep:known chromosome:UMD3.1:3:20187039:20195550:-1 gene:ENSBTAG00000003604 transcript:ENSBTAT00000004686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKWAGRPQLCLMLLLSLPQLCLDQEVLSGHSLQTPPEESQGPEGVWGPWDQWASCSQPC
GVGVQRRSRTCQLPTTQLHQGLPLPPRPPRHPEALLPRGQGTRPQTSRETLPLYRPPPRG
RGGPLRGPASQLGREEAPETQGARRSRVRDPIKPGMFGYGRVPFALPLHRNRRHPRRPPR
SELSQTSDLPSLTPRTEPSSSNHTQKTELSPTEPSAHTLPPQAEPPSPEAAQTAVPSRAR
PAPTGPHPRAQASGTESSFHSPSPGEGSSFHLSLQPRRPSSQGWASPRLADRHPNPFLSV
PWGRGQQSQEQWRPGGNLHGSLTESAPPQPDGWLPLLSSGPHSSPLWSLFAPSSPVPRCS
GESEQLRACSQAPCPAEQPDPRALQCAAFDSQEFMGQLYQWEPFTEVQGSQRCELNCRPR
GFRFYVRHTQKVQDGTLCQPGSLDICVAGRCLSPGCDGILGSGRHPDGCGVCGGDDSTCR
LVLGNLTERGGPLGYQKILSIPAGASRLQIAQLRPSSNYLALRGPGGRSIINGNWAVDPP
GSYTAGGTVFRYNRPPREEGAGESLSAEGPTTQPVDVYMIFQEENPGVFYQYVISSPPPN
LENPTPEPRVPQLQPEILRVEPPPVSAPRPARTPGTLQRQVRIPQMPAPPPPRTPLGSPA
GYWKRVGHSECSASCGKGVWRPIFLCISRESGEELDERSCAMGARPPASQEPCHGPPCPP
YWEAGEWTSCSRSCGPGTQHRQLRCRQEFGGGGSSVPLERCGHLPRPNITQPCQLRLCGH
WEVRSPWSQCSVRCGRGQRSRQVRCVGNNGDEVSEQECASGPPRPPSREACDMGPCTTAW
FHSDWSSKCSAECGTGIQRRSVVCLGSGEAHGISQEEAGAGAGEQTCAPGSRPPDMRACS
LGPCEVSWCWYTGPWAECSSECGSGTQRRDVICVSKLGTEFNVTSPSNCSHLPRPPALQP
CQGQDCQDRWFSTPWSPCSRSCQGGVQTREVQCLTANQTLSIRCPLHLRPARKRSCNSQP
CSQRPDDQCKDSSPHCPLVVQARLCVYPYYTATCCRSCAHVLERSSPEPA
Download sequence
Identical sequences F1MXR3
9913.ENSBTAP00000004686 ENSBTAP00000004686 ENSBTAP00000004686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]