SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000004746 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000004746
Domain Number 1 Region: 43-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.05e-34
Family SCAN domain 0.0000713
Further Details:      
 
Domain Number 2 Region: 162-211
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-18
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000004746   Gene: ENSBTAG00000003638   Transcript: ENSBTAT00000004746
Sequence length 381
Comment pep:known_by_projection chromosome:UMD3.1:15:46385477:46412894:-1 gene:ENSBTAG00000003638 transcript:ENSBTAT00000004746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPLSKLMTISKPHNLTPHEQSEVLRADTSWQQETIAVMETDDCEASRQKFRHFQYLEVS
GPREALSQLWELSLQWLRPEIHTKKQILELLVLEQFLTILPEEVRTWVNLQHPKNSKEVV
SLIQDVIDMLEDEGITCKDSVLHQKGSFKKEKMEADLITGKSQEPVKLEDVVVEFSKEEW
GQLDPAVKNLYRHVMLENYRNLNSLHKEHLLSKPVETSKLESKKESWIMEQEIPRTAVFD
RERISENQELVPKQRISGEESSHAVIMTRLTEGEHFPVDAWNSDDWLYRNQEPWDTNLPQ
EVFIPNIMYTEEGDFEYSENKMDLITYVSLLLLTPNILSLPLAPQDNVFLSWAHSYAAFH
NRSNCWVCRALPSSSVEGVPW
Download sequence
Identical sequences F1MUZ5
XP_005216178.1.76553 XP_010810867.1.76553 ENSBTAP00000004746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]