SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000005560 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000005560
Domain Number 1 Region: 118-326
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.95e-54
Family DBL homology domain (DH-domain) 0.000000016
Further Details:      
 
Domain Number 2 Region: 608-706,750-776
Classification Level Classification E-value
Superfamily SH2 domain 6.71e-24
Family SH2 domain 0.00075
Further Details:      
 
Domain Number 3 Region: 1-167
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.08e-20
Family Calponin-homology domain, CH-domain 0.02
Further Details:      
 
Domain Number 4 Region: 313-431
Classification Level Classification E-value
Superfamily PH domain-like 3.47e-18
Family Pleckstrin-homology domain (PH domain) 0.0073
Further Details:      
 
Domain Number 5 Region: 523-595
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000249
Family SH3-domain 0.0000299
Further Details:      
 
Domain Number 6 Region: 719-764
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000066
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000005560   Gene: ENSBTAG00000039160   Transcript: ENSBTAT00000005560
Sequence length 784
Comment pep:known_by_projection chromosome:UMD3.1:7:18866561:18937070:-1 gene:ENSBTAG00000039160 transcript:ENSBTAT00000005560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFLCLKNIRTFLSTCYEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPIAQNKGIM
PFPTEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEVYEDLMRSEPVPMPPK
MTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKPQDVEIIFINIEDLLRVHT
HFLKEMKEALANPGASTLYQVFIKYKESRFLIYGRYCSQVESASKHLDRVATAREDVQMK
LEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQDAMEKDNLRLALDAMRDLA
QCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKMDRYAFLL
DKALLICKRRGDTYDLKDFVNLHSFQVRDDSSGERDNKKWRGGEYFIHTHVQNKITMFCK
FKNVKKKWLNSYHLALSSLRGSACDRNHIDFALHSDLGLLVSKCNVCLGLKSGEFPNVYT
CICCCRLSINCINKLDNRHKMPYSRKGLLTQPLSQTGGLSKHPLPSPPGLPKMEVCQEYY
GLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNISTNEVGWFPCNRVKPYVHCKLR
EPLFLVCLDRYAGPMERAGAESILTNRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKIM
TAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPERRAINKPSAGSI
KIFGTAKARYDFCARDRSELSLKEGDIVKILNKKGQQGWWRGEIYGRIGWFPSNYVEEDY
SEYC
Download sequence
Identical sequences F1MSK3
ENSBTAP00000050922 ENSBTAP00000005560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]